Description
TB500 is a peptide known for its potential to improve recovery, flexibility, and overall performance.
Hypothetically, it could help:
- Enhance muscle and tissue repair
- Promote joint and ligament health
- Boost recovery times for athletes pushing their limits.
Our TB500 5mg is strictly manufactured in a fully certified laboratory that is cGMP and IS09001 compliant. This research product is for sale for the strict use in in-vitro research only. At PeptidesUK you are always guaranteed a purity of >98% from all our listed peptides.
Our peptide vials are safely stored in a fully monitored and temperature controlled system which maintains high-quality and purity. TB500 (Thymosin Beta 4) is also strictly tested for purity by HPLC and MS-UPLC analysis.
- Peptide Name: TB500 5mg
- Molecular Formula: C212/H350/N56/O78/S
- Molecular Weight: 4963.4 g/mol
- Purity: 98%
- Sequence:SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
- Form: Lyophilised Solid
TB-500, available in a 5mg formulation, stands as a top-quality, specialized research peptide meticulously crafted for cutting-edge scientific investigation into cellular rejuvenation and tissue restoration.
TB500 Storage and Usage
TB500 comes in lyophilized form for optimal stability and convenient use in research settings.
Peptides UK Products are sold strictly for research purposes only. Please do not ask about human consumption as this is forbidden.
Reviews
There are no reviews yet.